Overview

  • Product name

    Recombinant Human DDX50 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETREN GVTDDLDAPKAKKSKMKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGD IDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQKEGAFSNFPISEETIK LLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQ RNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSVACFYGGTSYQ SQINHIRNGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGF AEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAKKYMKSRYEQVDL VGKMTQKAATTVEHLAIQCHWSQRPAVIGDVLQVYSGSEGRAIIFCETKK NVTEMAMNPHIKQNAQCLHGDIAQSQREITLKGFREGSFKVLVATNVAAR GLDIPEVDLVIQSSPPQDVESYIHRSGRTGRAGRTGICICFYQPRERGQL RYVEQKAGITFKRVGVPSTMDLVKSKSMDAIRSLASVSYAAVDFFRPSAQ RLIEEKGAVDALAAALAHISGASSFEPRSLITSDKGFVTMTLESLEEIQD VSCAWKELNRKLSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHD SDWILSVPAKLPEIEEYYDGNTSSNSRQRSGWSSGRSGRSGRSGGRSGGR SGRQSRQGSRSGSRQDGRRRSGNRNRSRSGGHKRSFD
    • Molecular weight

      109 kDa including tags
    • Amino acids

      1 to 737

Specifications

Our Abpromise guarantee covers the use of ab132541 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 4933429B04Rik
    • ATP-dependent RNA helicase DDX50
    • Ddx50
    • DDX50_HUMAN
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 50
    • DEAD box protein 50
    • Gu beta
    • Gu-beta
    • GU2
    • GUB
    • MGC109605
    • MGC3199
    • Nucleolar protein Gu2
    • RH II
    • RH II/GuB
    • RNA helicase II / Gu beta
    see all
  • Sequence similarities

    Belongs to the DEAD box helicase family. DDX21/DDX50 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab132541 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132541.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up