Description

  • Product name

    Recombinant Human DDX53/CT26 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSHWAPEWKRAEANPRDLGASWDVRGSRGSGWSGPFGHQGPRAAGSREPP LCFKIKNNMVGVVIGYSGSKIKDLQHSTNTKIQIINGESEAKVRIFGNRE MKAKAKAAIETLIRKQESYNSESSVDNAASQTPIGRNLGRNDIVGEAEPL SNWDRIRAAVVECEKRKWADLPPVKKNFYIESKATSCMSEMQVINWRKEN FNITCDDLKSGEKRLIPKPTCRFKDAFQQYPDLLKSIIRVGILKPTPIQS QAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPISREQRNGPGML VLTPTRELALHVEAECSKYSYKGLKSICIYGGRNRNGQIEDISKGVDIII ATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPD RQTVMTSATWPDTVRQLALSYLKDPMIVYVGNLNLVAVNTVKQNIIVTTE KEKRALTQEFVENMSPNDKVIMFVSQKHIADDLSSDFNIQGISAESLHGN SEQSDQERAVEDFKSGNIKILITTDIVSRGLDLNDVTHVYNYDFPRNIDV YVHRVGYIGRTGKTGTSVTLITQRDSKMAGELIKILDRANQSVPEDLVVM AEQYKLNQQKRHRETRSREPGQRRKEFYFLS
    • Amino acids

      1 to 631
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as DDX53.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CAGE
    • Cancer associated gene protein
    • Cancer-associated gene protein
    • Cancer/testis antigen 26
    • CT26
    • DDX53
    • DDX53_HUMAN
    • DEAD (Asp Glu Ala Asp) box polypeptide 53
    • DEAD box protein 53
    • DEAD box protein CAGE
    • Probable ATP dependent RNA helicase DDX53
    • Probable ATP-dependent RNA helicase DDX53
    see all
  • Tissue specificity

    Expressed in testis. Wide expression in various cancer tissues and cancer cell lines.
  • Sequence similarities

    Belongs to the DEAD box helicase family.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 KH domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab165799 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up