Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      IKEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPP ALRGLVRPHKKRKKLSSSCRKAKRAKSQNPLRSFKHKGKKFRPTAKPS
    • Amino acids

      450 to 547
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as DDX56

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 61 kd nucleolar helicase
    • ATP-dependent 61 kDa nucleolar RNA helicase
    • DDX21
    • DDX26
    • Ddx56
    • DDX56_HUMAN
    • DEAD (Asp-Glu-Ala-Asp) box helicase 56
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 56
    • DEAD box protein 21
    • DEAD box protein 56
    • DEAD box RNA helicase
    • DEAD/H box 56
    • NOH61
    • Nucleolar helicase of 61 kDa
    • Probable ATP-dependent RNA helicase DDX56
    • Putative nucleolar RNA helicase
    see all
  • Function

    May play a role in later stages of the processing of the pre-ribosomal particles leading to mature 60S ribosomal subunits. Has intrinsic ATPase activity.
  • Tissue specificity

    Detected in heart, brain, liver, pancreas, placenta and lung.
  • Sequence similarities

    Belongs to the DEAD box helicase family. DDX56/DBP9 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab162803 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162803 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up