Overview

  • Product name
    Recombinant Human Dectin-1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVIL GILCLVILVIAVVLGTMAGFKAVEFKG
    • Amino acids
      1 to 77
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beta GR
    • Beta-glucan receptor
    • BGR
    • C type calcium dependent carbohydrate recognition domain lectin superfamily member 12
    • C type lectin domain family 7 member a
    • C-type lectin domain family 7 member A
    • C-type lectin superfamily member 12
    • CANDF4
    • CLC7A_HUMAN
    • CLEC7A
    • CLEC7A protein
    • Clecsf12
    • DC-associated C-type lectin 1
    • Dectin 1
    • DECTIN 1 receptor
    • Dectin-1
    • Dectin1
    • Dendritic cell associated C type lectin 1
    • Dendritic cell-associated C-type lectin 1
    • Lectin like receptor 1
    • Putative transmembrane protein dectin 1
    see all
  • Function
    Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation.
  • Tissue specificity
    Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta.
  • Involvement in disease
    Defects in CLEC7A may be a cause of familial candidiasis type 4 (CANDF4) [MIM:613108]. It is a rare disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues in response to glucan binding.
  • Cellular localization
    Cytoplasm and Cell membrane.
  • Information by UniProt

Images

  • ab163849 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163849 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163849.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up