Overview

  • Product name
    Recombinant Human DECTIN 2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLI STKENFWSTS EQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLS DPQGNGKWQWIDDTPFSQNVRF WHPHEPNLPEERCVSIVYWNPSKWGW NDVFCDSKHNSICEMKKIYL
    • Molecular weight
      55 kDa including tags
    • Amino acids
      44 to 209

Associated products

Specifications

Our Abpromise guarantee covers the use of ab157028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituent: 100% PBS

  • Reconstitution
    Reconstitute with 50µl sterile water. Further dilutions should be made with medium containing 5% fetal calf serum.

General Info

  • Alternative names
    • C type lectin domain family 6 member A
    • C type lectin superfamily member 10
    • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 10
    • C-type lectin domain family 6 member A
    • C-type lectin superfamily member 10
    • CLC6A_HUMAN
    • CLEC4N
    • CLEC4N, mouse, homolog of
    • Clec6a
    • CLECSF10
    • DC associated C type lectin 2
    • DC-associated C-type lectin 2
    • Dectin-2
    • Dectin2
    • Dendritic cell associated lectin 2
    • Dendritic cell-associated C-type lectin 2
    see all
  • Function
    Binds high-mannose carbohydrates in a Ca(2+)-dependent manner. Functional receptor for alpha-mannans on C.albicans hypheas. Plays an important role in the host defense against C.albicans infection by inducing TH17 cell differentiation. Recognizes also, in a mannose-dependent manner, allergens from house dust mite and fungi, by promoting cysteinyl leukotriene production. Recognizes soluble elements from the eggs of Shistosoma mansoni altering adaptive immune responses. Transduces signals through an Fc receptor gamma chain /FCER1G and Syk-CARD9-NF-kappa-B-dependent pathway.
  • Tissue specificity
    Expressed in lung, spleen, lymph node, leukocytes, bone marrow, tonsils and dendritic cells. Strongly expressed in purified monocytes and weakly in B-cells. In peripheral blood cells, preferentially expressed in plasmacytoids rather than myeloids.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Domain
    A short stretch of the intracellular domain (AA 8-14) proximal to the transmembrane domain is required for association with Fc receptor gamma chain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab157028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up