Recombinant human DEFB-4 protein (Active) (ab218675)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, HPLC, Functional Studies
Description
-
Product name
Recombinant human DEFB-4 protein (Active)
See all DEFB-4 proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 0.1 -100.0 ng/ml.
-
Purity
> 98 % SDS-PAGE.
> 98 % by HPLC analysis. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP -
Predicted molecular weight
6 kDa -
Amino acids
23 to 72 -
Additional sequence information
This product is the mature full length protein from aa 23 to 72. The signal peptide is not included. Single, non-glycosylated polypeptide chain.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab218675 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
Functional Studies
-
Form
Lyophilized -
Additional notes
Protein previously labeled as beta 4 Defensin.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C. Store under desiccating conditions.
pH: 7.40
Constituents: 99% Phosphate Buffer, 0.75% Sodium chloride
Lyophilised from a 0.2µm filtered concentrated solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge vial prior to opening. Add sterile distilled water or aqueous buffer to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions. Upon reconstitution, the preparation is stable for up to one week at 2 -4°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -80°C. Avoid repeated freeze/thaw cycles.
General Info
-
Alternative names
- BD 4
- BD-4
- BD4
see all -
Function
Has antimicrobial activity. Synergistic effects with lysozyme and DEFB103. -
Tissue specificity
High expression in the testis. Gastric antrum exhibited relatively high levels. A lower expression is observed in uterus and neutrophils thyroid gland, lung, and kidney. No detectable expression in other tissues tested. -
Sequence similarities
Belongs to the beta-defensin family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab218675 has not yet been referenced specifically in any publications.