Description

  • Product name

    Recombinant human DEFB-4 protein (Active)
    See all DEFB-4 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 0.1 -100.0 ng/ml.

  • Purity

    > 98 % SDS-PAGE.
    > 98 % by HPLC analysis.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
    • Predicted molecular weight

      6 kDa
    • Amino acids

      23 to 72
    • Additional sequence information

      This product is the mature full length protein from aa 23 to 72. The signal peptide is not included. Single, non-glycosylated polypeptide chain.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab218675 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Protein previously labeled as beta 4 Defensin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Store under desiccating conditions.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.75% Sodium chloride

    Lyophilised from a 0.2µm filtered concentrated solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial prior to opening. Add sterile distilled water or aqueous buffer to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions. Upon reconstitution, the preparation is stable for up to one week at 2 -4°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -80°C. Avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • BD 4
    • BD-4
    • BD4
    • beta 104
    • beta 4 Defensin
    • Beta defensin 4
    • Beta-defensin 104
    • Beta-defensin 4
    • D104A_HUMAN
    • DEFB-4
    • DEFB104B
    • Defensin
    • Defensin beta 104
    • Defensin beta 4 precursor
    • hBD 4
    • hBD-4
    • hBD4
    see all
  • Function

    Has antimicrobial activity. Synergistic effects with lysozyme and DEFB103.
  • Tissue specificity

    High expression in the testis. Gastric antrum exhibited relatively high levels. A lower expression is observed in uterus and neutrophils thyroid gland, lung, and kidney. No detectable expression in other tissues tested.
  • Sequence similarities

    Belongs to the beta-defensin family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab218675.

References

ab218675 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218675.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up