Description

  • Product name

    Recombinant Human Delta-catenin protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGA PAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRP PASEYTMHLG
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      1081 to 1190

Specifications

Our Abpromise guarantee covers the use of ab152307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as delta 2 Catenin

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ARM-repeat protein
    • Catenin (cadherin associated protein) delta 2
    • catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein)
    • Catenin delta 2
    • Catenin delta-2
    • CTND2_HUMAN
    • CTNND 2
    • Ctnnd2
    • Delta catenin
    • Delta-catenin
    • GT 24
    • GT24
    • Neural plakophilin related arm repeat protein
    • Neural plakophilin related armadillo repeat protein
    • Neural plakophilin-related ARM-repeat protein
    • Neural plakophilin-related, Neurojungin
    • Neurojungin
    • NPRAP
    • T cell delta catenin
    see all
  • Function

    Functions as a transcriptional activator when bound to ZBTB33 (By similarity). May be involved in neuronal cell adhesion and tissue morphogenesis and integrity by regulating adhesion molecules.
  • Tissue specificity

    Predominantly expressed in brain.
  • Sequence similarities

    Belongs to the beta-catenin family.
    Contains 9 ARM repeats.
  • Post-translational
    modifications

    O-glycosylated.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Cell junction > adherens junction.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152307 stained with Coomassie Blue.

References

ab152307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up