Overview

  • Product name

    Recombinant Human Dematin protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MERLQKQPLTSPGSVSPSRDSSVPGSPSSIVAKMDNQVLGYKDLAAIPKD KAILDIERPDLMIYEPHFTYSLLEHVELPRSRERSLSPKSTSPPPSPEVW ADSRSPGIISQASAPRTTGTPRTSLPHFHHPETSRPDSNIYKKPPIYKQR ESVGGSPQTKHLIEDLIIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAV VETEWRKRKASRRGAEEEEEEEDDDSGEEMKALRERQREELSKVTSNLGK MILKEEMEKSLPIRRKTRSLPDRTPFHTSLHQGTSKSSSLPAYGRTTLSR LQSTEFSPSGSETGSPGLQIYPYEMLVVTNKGRTKLPPGVDRMRLERHLS AEDFSRVFAMSPEEFGKLALWKRNELKKKASLF
    • Amino acids

      1 to 383
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DEMA
    • DEMA_HUMAN
    • Dematin
    • DMT
    • EPB49
    • Erythrocyte membrane protein band 4.9
    • erythrocyte membrane protein band 4.9 (dematin)
    see all
  • Function

    Actin-bundling protein. May function in mitogen-activated protein kinase pathway.
  • Tissue specificity

    Heart, brain, lung, skeletal muscle, and kidney.
  • Sequence similarities

    Belongs to the villin/gelsolin family.
    Contains 1 HP (headpiece) domain.
  • Domain

    Contains at least two actin-binding sites, one in the headpiece domain and one in the amino-terminal portion.
    Consists of a large core fragment, the amino-terminal portion, and a small headpiece, the C-terminal portion. The headpiece can bind but cannot bundle actin filaments.
  • Post-translational
    modifications

    Actin-bundling activity is abolished upon phosphorylation by cAMP-dependent protein kinase.
    The N-terminus is blocked.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab158367 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158367 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158367.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up