Overview

  • Product name
    Recombinant Human DENND4A protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIEDKGPRVADYFVVAGLTDVSKPLEEEIHFNDACHKVAKPKEPITDVSV IIKSLGEEVPQDYICIDVTPTGLSADLNNGSLVGPQIYLCYRRGRDKPPL T
    • Amino acids
      1 to 101
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C-myc promoter-binding protein
    • DENN domain-containing protein 4A
    • DENN/MADD domain containing 4A
    • DENND4A
    • FLJ33949
    • IRLB
    • KIAA0476
    • MYCPBP
    • MYCPP_HUMAN
    see all
  • Function
    Binds to ISRE-like element (interferon-stimulated response element) of MYC P2 promoter.
  • Tissue specificity
    Expressed ubiquitously. Highest expression in bone marrow, medium in peripheral blood lymphocytes and lowest in spleen. In brain, breast, and prostate, higher expression was seen in normal cells than in tumor cells. Expression is regulated in a growth- and cell cycle-dependent manner.
  • Sequence similarities
    Contains 1 dDENN domain.
    Contains 1 DENN domain.
    Contains 1 MABP domain.
    Contains 2 PPR (pentatricopeptide) repeats.
    Contains 1 uDENN domain.
  • Developmental stage
    Highly expressed in fetal liver.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160908 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160908 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160908.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up