Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPPLCDGFGTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFLMDNYQEI LKVPLALQTSIEERVAHLRRVQVKYPGADMDITLSAPSFCRQISPEEFEY QRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKSYPEVYQERFPTP ESAALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM
    • Amino acids
      1 to 187
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163220 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BRCC3
    • Breast cancer cell 3
    • DEP domain containing 1B
    • DEP domain containing protein 1B
    • FLJ11252
    • HBV X transactivated gene 8 protein
    • HBV X-transactivated gene 8 protein
    • HBV XAg-transactivated protein 8
    • HBxAg transactivated protein 1
    • OTTHUMP00000122605
    • OTTHUMP00000221973
    • XTP1
    • XTP8
    see all
  • Relevance
    GTPase activator activity. biological process: intracellular signaling cascade
  • Cellular localization
    intracellular

Images

  • ab163220 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163220 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163220.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up