Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEAARPSGSWNGALCRLLLLTLAILIFASDACKNVTLHVPSKLDAEKLVG RVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSN TENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLG PFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRP VDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTF TIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPT TGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVND HLPTFTRTSYVTSVEENTVDVEILRVTVEDKDLVNTANWRANYTILKGNE NGNFKIVTDAKTNEGVLCVVKPLNYEEKQQMILQIGVVNEAPFSREASPR SAMSTATVTVNVEDQDEGPECNPPIQTVRMKENAEVGTTSNGYKAYDPET RSSSGIRYKKLTDPTGWVTIDENTGSIKVFRSLDREAETIKNGIYNITVL ASDQGGRTCTGTLGIILQDVNDNSPFIPKKTVIICKPTMSSAEIVAVDPD EPIHGPPFDFSLESSTSEVQRMWRLKAINDTAARLSYQNDPPFGSYVVPI TVRDRLGMSSVTSLDVTLCDCITENDCTHRVDPRIGGGGVQLGKWAILAI LLGIALLFCILFTLVCGASGTSKQPKVIPDDLAQQNLIVSNTEAPGDDKV YSANGFTTQTVGASAQGVCGTVGSGIKNGGQETIEMVKGGHQTSESCRGA GHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEESIRGHTLIKN
    • Amino acids
      1 to 847
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARVD11
    • Cadherin family member 2
    • CDHF2
    • Desmocollin 3
    • Desmocollin-2
    • Desmocollin-3
    • Desmocollin2
    • Desmosomal glycoprotein II
    • Desmosomal glycoprotein II and III
    • Desmosomal glycoprotein II/III
    • Desmosomal glycoprotein III
    • DG2
    • DGII/III
    • DKFZp686I11137
    • DSC 2
    • DSC2
    • DSC2_HUMAN
    • DSC3
    see all
  • Function
    Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. May contribute to epidermal cell positioning (stratification) by mediating differential adhesiveness between cells that express different isoforms.
  • Tissue specificity
    Expressed in epithelia, myocardium and lymph nodes.
  • Involvement in disease
    Defects in DSC2 are the cause of familial arrhythmogenic right ventricular dysplasia type 11 (ARVD11) [MIM:610476]; also known as arrhythmogenic right ventricular cardiomyopathy 11 (ARVC11). ARVD is an autosomal dominant disease characterized by partial degeneration of the myocardium of the right ventricle, electrical instability, and sudden death. It is clinically defined by electrocardiographic and angiographic criteria; pathologic findings, replacement of ventricular myocardium with fatty and fibrous elements, preferentially involve the right ventricular free wall.
  • Sequence similarities
    Contains 5 cadherin domains.
  • Domain
    Calcium may be bound by the cadherin-like repeats.
  • Cellular localization
    Cell membrane. Cell junction > desmosome.
  • Information by UniProt

Images

  • ab158317 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158317 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up