Description

  • Product name

    Recombinant Human Desmocollin 3 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      CKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVNDTAAR LSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRST
    • Amino acids

      585 to 684
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cadherin family member 3
    • CDHF3
    • desmocollin 3a/3b
    • Desmocollin 4
    • Desmocollin-3
    • Desmocollin-4
    • Desmocollin3
    • Desmocollin4
    • DSC
    • DSC1
    • DSC2
    • DSC3
    • DSC3_HUMAN
    • DSC4
    • HT CP
    • HT-CP
    • HTCP
    see all
  • Function

    Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. May contribute to epidermal cell positioning (stratification) by mediating differential adhesiveness between cells that express different isoforms.
  • Tissue specificity

    Epidermis, buccal mucosa, esophagus and cervix.
  • Involvement in disease

    Defects in DSC3 are the cause of hypotrichosis and recurrent skin vesicles (HRSV) [MIM:613102]. A disorder characterized by hypotrichosis and the appearance of recurrent skin vesicle formation. Affected individuals show sparse and fragile hair on scalp, as well as absent eyebrows and eyelashes. Vesicles filled with thin, watery fluid are observed on the scalp and skin of most of the boby. Mucosal vesicles are absent.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Domain

    Calcium may be bound by the cadherin-like repeats.
  • Cellular localization

    Cell membrane. Cell junction > desmosome.
  • Information by UniProt

Images

  • ab158320 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158320 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up