Overview

  • Product name
    Recombinant Human Desmoglein 4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EPPGIADMWDVRSTNATSAILTAKQVLSPGFYEIPILVKDSYNRACELAQ MVQLYACDCDDNHMCLDSGAAGIYTEDITGDTYGPVTEDQAGVSNVGLGP
    • Amino acids
      531 to 630
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165556 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDGF 13
    • CDGF13
    • CDH family member 13
    • CDHF 13
    • CDHF13
    • Desmoglein 4
    • Desmoglein4
    • DSG 4
    • DSG4
    • LAH
    see all
  • Relevance
    DSG4(Desmoglein 4) is a component of intercellular desmosome junctions. DSG4 is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. DSG4 coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. The essential role of desmoglein 4 in skin was established by identifying mutations in families with inherited hypotrichosis, as well as in the lanceolate hair mouse. The human desmoglein 4 gene (DSG4) demonstrates that it is composed of 16 exons spanning approximately 37 kb of 18q12 and is situated between DSG1 and DSG3. Defects in DSG4 are the cause of localized autosomal hypotrichosis (LAH). LAH is an autosomal recessive skin disorder. DSG4 is one of the target molecules recognized by autoantibodies in patients with pemphigus vulgaris. Pemphigus vulgaris is a potentially lethal skin disease in which epidermal blisters occur as the result of the loss of cell-cell adhesion.
  • Cellular localization
    Cell membrane; single pass type I membrane protein.

Images

  • ab165556 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165556 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165556.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up