Description

  • Product name

    Recombinant Human Desmoplakin protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIRE MRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSG SGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNS IGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQ ATSREIMWINDCEEEELLYDWSD
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      78 to 300
    • Tags

      His tag N-Terminus
    • Additional sequence information

      6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab225667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • 250/210 kDa paraneoplastic pemphigus antigen
    • Desmoplakin I
    • Desmoplakin II
    • DP I
    • DP II
    • DPI
    • DPII
    • DSP
    • KPPS2
    • PPKS2
    see all
  • Relevance

    Desmosomes are the most common type of intercellular junction in vertebrate epithelial cells. They are characterized by 2 forms of interaction with other cellular structures. First, they form membrane anchorage sites for intermediate-size filaments, which are seen as electron-dense plaques evident beneath the plasma membrane. Second, a specific membrane core domain interacts with a corresponding domain of the plasma membrane of an adjacent cell, apparently mediating intercellular adhesion in a stable way. The desmosome intermediate filament complex is thought to impart tensile strength and resilience to the epithelium. Desmosomal proteins can be divided into 2 groups based on whether they fractionate with the urea-insoluble 'core' or the urea-soluble 'plaque' components. Desmoglein is, for example, a protein of the core. The main proteins of the plaque comprise the desmoplakins and plakoglobin.
  • Cellular localization

    Cell junction, desmosome. Cytoplasm, cytoskeleton.

Images

  • Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225667 with 5% enrichment gel and 15% separation gel.

References

ab225667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up