Description

  • Product name

    Recombinant Human Dexras1 protein
    See all Dexras1 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFE DAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFI LVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPLVICGNKGDRD FYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSE MSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFA RRPSVHSDLMYIREKASAGSQAKDKERCVIS
    • Predicted molecular weight

      58 kDa including tags
    • Amino acids

      1 to 281

Specifications

Our Abpromise guarantee covers the use of ab131904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Activator of G protein signaling
    • Activator of G protein signaling 1
    • Activator of G-protein signaling 1
    • AGS 1
    • AGS1
    • Dexamethasone induced ras related protein 1
    • Dexamethasone-induced ras protein 1
    • Dexamethasone-induced Ras-related protein 1
    • Dexras 1
    • MGC:26290
    • RAS dexamethasone induced 1
    • Ras protein, Dexamethasone-induced, 1
    • Ras related protein
    • RASD 1
    • Rasd1
    • RASD1_HUMAN
    see all
  • Function

    Small GTPase. Negatively regulates the transcription regulation activity of the APBB1/FE65-APP complex via its interaction with APBB1/FE65.
  • Tissue specificity

    Expressed in a variety of tissues including heart, cardiovascular tissues, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, gastrointestinal and reproductive tissues.
  • Sequence similarities

    Belongs to the small GTPase superfamily. RasD family.
  • Post-translational
    modifications

    S-nitrosylation stimulates guanine-nucleotide exchange activity.
  • Cellular localization

    Cell membrane. Cytoplasm > perinuclear region. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131904 stained with Coomassie Blue.

References

ab131904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up