Recombinant Human DFFB/CAD protein (ab158274)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLQKPKSVKLRALRSPRKFGVAGRSCQEVLRKGCLRFQLPERGSRLCLYE DGTELTEDYFPSVPDNAELVLLTLGQAWQGYVSDIRRFLSAFHEPQVGLI QAAQQLLCDEQAPQRQRLLADLLHNVSQNIAAETRAEDPPWFEGLESRFQ SKSGYLRYSCESRIRSYLREVSSYPSTVGAEAQEEFLRVLGSMCQRLRSM QYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESR ILFSTWNLDHIIEKKRTIIPTLVEAIKEQDGREVDWEYFYGLLFTSENLK LVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRKRQ
    • Amino acids
      1 to 338
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158274 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     

    Product previously known as Recombinant Human DFFB protein.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAD
    • Caspase activated deoxyribonuclease
    • Caspase activated DNase
    • Caspase activated nuclease
    • Caspase-activated deoxyribonuclease
    • Caspase-activated DNase
    • Caspase-activated nuclease
    • CPAN
    • Deoxyribonuclease III, caspase activated
    • DFF 40
    • DFF-40
    • DFF2
    • DFF40
    • Dffb
    • DFFB_HUMAN
    • Didff
    • DNA fragmentation factor 40 kDa subunit
    • DNA fragmentation factor subunit beta
    • DNA fragmentation factor, 40 Da, beta polypeptide (caspase activated DNase)
    • DNA fragmentation factor, 40 kD beta subunit
    • DNA fragmentation factor, 40 kD, beta polypeptide
    • DNA fragmentation factor, 40kDa, beta polypeptide (caspase activated DNase)
    • OTTHUMP00000003633
    see all
  • Function
    Nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. Degrades naked DNA and induces apoptotic morphology.
  • Sequence similarities
    Contains 1 CIDE-N domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab158274 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158274 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158274.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up