Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMD VGSGGDGQSELPAEDPFNFYGASLLSKGSFSKGRLLIDPNCSGHSPRTAR HAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGAERDVRAECGL LLSPVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEKRVEYAVLD ELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDAL LEEGLCAPKKRRTEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPT EPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSI PCLHYKKMKDNEEREQSSDLTPSGDVSPVKPLSRSAELEFPLDEPDSMGA DPGPPDEKDPLGAEAAPGALGQVKAKVEVCKDESVDLEEFRSYLEKRFDF EQVTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLITLSVQDAPTK KEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDG VTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKPKDSEELEYFNH ISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQK SEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGR ESSKMVKQETSDKSVIELQQYAKKNKPNLHILSKLQEEMKRLAEEREETR KKPKMSIVASAQPGGEPLCTVDV
    • Amino acids

      1 to 773
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153373 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DGCRK6
    • C22orf12
    • D16H22S788E
    • D16Wis2
    • DGCR 8
    • Dgcr8
    • DGCR8 microprocessor complex subunit
    • DGCR8_HUMAN
    • DGCRK 6
    • DiGeorge syndrome critical region 8
    • DiGeorge syndrome critical region gene 8
    • Gy1
    • Microprocessor complex subunit DGCR8
    • pasha
    see all
  • Function

    Component of the microprocessor complex that acts as a RNA- and heme-binding protein that is involved in the initial step of microRNA (miRNA) biogenesis. Component of the microprocessor complex that is required to process primary miRNA transcripts (pri-miRNAs) to release precursor miRNA (pre-miRNA) in the nucleus. Within the microprocessor complex, DGCR8 function as a molecular anchor necessary for the recognition of pri-miRNA at dsRNA-ssRNA junction and directs DROSHA to cleave 11 bp away form the junction to release hairpin-shaped pre-miRNAs that are subsequently cut by the cytoplasmic DICER to generate mature miRNAs. The heme-bound DGCR8 dimer binds pri-miRNAs as a cooperative trimer (of dimers) and is active in triggering pri-miRNA cleavage, whereas the heme-free DGCR8 monomer binds pri-miRNAs as a dimer and is much less active. Both double-stranded and single-stranded regions of a pri-miRNA are required for its binding. Involved in the silencing of embryonic stem cells self-renewal.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Contains 2 DRBM (double-stranded RNA-binding) domains.
    Contains 1 WW domain.
  • Domain

    Both DRBM domains are required for efficient binding to pri-miRNA. The region between residues 276 and 498 has an autoinhibitory function on pri-miRNA processing activity.
  • Cellular localization

    Nucleus. Nucleus > nucleolus. Colocalizes with nucleolin and DROSHA in the nucleolus. Mostly detected in the nucleolus as electron-dense granular patches around the fibrillar center (FC) and granular component (GC). Also detected in the nucleoplasm as small foci adjacent to splicing speckles near the chromatin structure. Localized with DROSHA in GW bodies (GWBs), also known as P-bodies.
  • Information by UniProt

Images

  • ab153373 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153373 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153373.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up