Recombinant Human DHDDS protein (ab164163)

Description

  • Product name

    Recombinant Human DHDDS protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEG HSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQK FSRLMEEKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLD KCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWN LFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQAS GDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA
    • Amino acids

      1 to 294
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Dehydrodolichyl Diphosphate Synthase. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • cis-IPTase
    • Cis-isoprenyltransferase
    • cis-prenyl transferase
    • CIT
    • CPT
    • Dedol PP synthase
    • dedol-PP synthase
    • dehydrodolichyl diphosphate synthase
    • DHDDS
    • DS
    • Epididymis tissue protein Li 189m
    • HDS
    • RP3-476K8.2
    • RP59
    see all
  • Relevance

    Catalyzes cis prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoprotein.

Images

  • ab164163 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up