Description

  • Product name

    Recombinant Human DHX8/prp22 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNR RRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      301 to 400

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.

     This product was previously labelled as DHX8

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP dependent RNA helicase DHX8
    • ATP-dependent RNA helicase dhx8
    • DDX 8
    • DDX8
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 8
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 8 (RNA helicase)
    • DEAD/H box 8
    • DEAD/H box polypeptide 8
    • DEAH (Asp Glu Ala His) box polypeptide 8
    • DEAH box polypeptide 8
    • DEAH box protein 8
    • DHX 8
    • dhx8
    • DHX8_HUMAN
    • HRH 1
    • HRH1
    • PRP 22
    • PRP22
    • PRP22, S. cerevisiae, homolog of
    • PRPF 22
    • PRPF22
    • RNA helicase HRH 1
    • RNA helicase HRH1
    see all
  • Function

    Facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome.
  • Sequence similarities

    Belongs to the DEAD box helicase family. DEAH subfamily. DDX8/PRP22 sub-subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 S1 motif domain.
  • Domain

    The RS domain confers a nuclear localization signal, and appears to facilitate the interaction with the spliceosome.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114918 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References

ab114918 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up