Recombinant Human Diacylglycerol acyltransferase 2 protein (ab165711)

Description

  • Product name

    Recombinant Human Diacylglycerol acyltransferase 2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFA WLFLDWKTPERGGRRSAWVRNWCVWTHIRDYFPITILKTKDLSPEHNYLM GVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYL MAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILQKR KGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKFQSCFRRIFGF YCCVFYGQSFCQGSTGLLPYSRPIVTVVGEPLPLPQIEKPSQEMVDKYHA LYMDALHKLFDQHKTHYGCSETQKLFFL
    • Amino acids

      1 to 328
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165711 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as DGAT2L3. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Acyl-CoA wax alcohol acyltransferase 1
    • Awat1
    • AWAT1_HUMAN
    • DGA
    • DGA2
    • DGAT2L3
    • Diacyl glycerol acyltransferase 2
    • Diacylglycerol acyltransferase 2
    • Diacylglycerol O acyltransferase 2 like 3
    • Diacylglycerol O-acyltransferase 2-like protein 3
    • Long-chain-alcohol O-fatty-acyltransferase 1
    see all
  • Function

    Acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. Has a preference for arachidyl alcohol as well as decyl alcohol, demonstrating its relatively poor activity using saturated long chain alcohols (C16, C18, and C20).
  • Tissue specificity

    Predominantly expressed in skin, where it is limited to the sebaceous gland. Expressed in more mature, centrally located cells just before their rupture and sebum release. Also expressed in all tissues except spleen. Expressed at higher level in thymus, prostate and testis.
  • Sequence similarities

    Belongs to the diacylglycerol acyltransferase family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab165711 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165711 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165711.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up