Overview

  • Product name
    Recombinant Human DIAPH1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNA GAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHV EKAS
    • Amino acids
      921 to 1024
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DIAPH1
    • deafness, autosomal dominant 1
    • DFNA1
    • DIA1
    • DIAP1
    • DIAP1_HUMAN
    • DIAPH1
    • diaphanous homolog 1
    • Diaphanous homolog 1 (Drosophila)
    • Diaphanous related formin 1
    • Diaphanous-related formin-1
    • DRF1
    • FLJ25265
    • hDIA1
    • LFHL1
    • low frequency hearing loss 1
    • p140DIA
    • Protein diaphanous homolog 1
    see all
  • Function
    Acts in a Rho-dependent manner to recruit PFY1 to the membrane. Required for the assembly of F-actin structures, such as actin cables and stress fibers. Nucleates actin filaments. Binds to the barbed end of the actin filament and slows down actin polymerization and depolymerization. Required for cytokinesis, and transcriptional activation of the serum response factor. DFR proteins couple Rho and Src tyrosine kinase during signaling and the regulation of actin dynamics. Functions as a scaffold protein for MAPRE1 and APC to stabilize microtubules and promote cell migration (By similarity). Has neurite outgrowth promoting activity (By similarity). In hear cells, it may play a role in the regulation of actin polymerization in hair cells. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization.
  • Tissue specificity
    Expressed in brain, heart, placenta, lung, kidney, pancreas, liver, skeletal muscle and cochlea.
  • Involvement in disease
    Defects in DIAPH1 are the cause of deafness autosomal dominant type 1 (DFNA1) [MIM:124900]. DFNA1 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities
    Belongs to the formin homology family. Diaphanous subfamily.
    Contains 1 DAD (diaphanous autoregulatory) domain.
    Contains 1 FH1 (formin homology 1) domain.
    Contains 1 FH2 (formin homology 2) domain.
    Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.
  • Domain
    DRFs are regulated by intramolecular GBD-DAD binding where Rho-GTP activates the DRFs by disrupting the GBD-DAD interaction (By similarity). DCAF7 binds to the FH2 (formin homology 2) domain.
  • Cellular localization
    Cell membrane. Cell projection > ruffle membrane. Cytoplasm > cytoskeleton. Membrane ruffles, especially at the tip of ruffles, of motile cells.
  • Information by UniProt

Images

  • ab158283 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up