Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADRGCPLEAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYI PLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTE
    • Amino acids
      1 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161563 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C21orf106
    • DIP 2A
    • DIP2
    • DIP2 disco interacting protein 2 homolog A
    • DIP2 homolog A
    • DIP2 like protein
    • Dip2a
    • DIP2A_HUMAN
    • Disco interacting protein 2 homolog
    • Disco-interacting protein 2 homolog A
    • KIAA0184
    see all
  • Function
    May provide positional cues for axon pathfinding and patterning in the central nervous system.
  • Tissue specificity
    Low expression in all tissues tested.
  • Sequence similarities
    Belongs to the DIP2 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161563 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161563 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161563.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up