Overview

  • Product name

    Recombinant Human DIS3 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      VVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVK IMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKL
    • Amino acids

      861 to 956
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161467 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as DIS3, Dis3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2810028N01Rik
    • bA555G22
    • Dis3
    • DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease
    • DIS3 mitotic control homolog
    • DIS3 mitotic control homolog (S. cerevisiae)
    • DIS3 mitotic control, S. cerevisiae, homolog of
    • dis3p
    • EXOSC11
    • Exosome complex exonuclease RRP44
    • exosome component 11
    • KIAA1008
    • Mitotic control protein dis3 homolog
    • Protein DIS3 homolog
    • Ribosomal RNA processing protein 44
    • Ribosomal RNA processing protein 44, S. cerevisiae, homolog of
    • Ribosomal RNA-processing protein 44
    • RP11-342J4.3
    • RRP44
    • RRP44_HUMAN
    see all
  • Function

    Putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as anti-sense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. DIS3 has both 3'-5' exonuclease and endonuclease activities.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the RNR ribonuclease family.
    Contains 1 PINc domain.
  • Cellular localization

    Cytoplasm. Nucleus > nucleolus. Nucleus > nucleoplasm. Nucleus. Predominantly located in the nucleus. According to PubMed:12429849, found in the nucleolus and according to PubMed:20531386, excluded from nucleolus supporting the existence of a nucleolar RNA exosome complex devoid of DIS3.
  • Information by UniProt

Images

  • ab161467 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161467 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161467.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up