Recombinant Human Dishevelled / Dvl1 protein (ab116823)
Key features and details
- Expression system: Wheat germ
- Suitable for: ELISA, SDS-PAGE, WB
Description
-
Product name
Recombinant Human Dishevelled / Dvl1 protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFK SMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHT DLPPPLERTG -
Predicted molecular weight
38 kDa including tags -
Amino acids
1 to 110
-
Specifications
Our Abpromise guarantee covers the use of ab116823 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
SDS-PAGE
Western blot
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Dishevelled
- Dishevelled 1
- dishevelled 1 like
see all -
Function
Participates in Wnt signaling by binding to the cytoplasmic C-terminus of frizzled family members and transducing the Wnt signal to down-stream effectors. Plays a role both in canonical and non-canonical Wnt signaling. Plays a role in the signal transduction pathways mediated by multiple Wnt genes. Required for LEF1 activation upon WNT1 and WNT3A signaling. DVL1 and PAK1 form a ternary complex with MUSK which is important for MUSK-dependent regulation of AChR clustering during the formation of the neuromuscular junction (NMJ). -
Involvement in disease
Robinow syndrome, autosomal dominant 2 -
Sequence similarities
Belongs to the DSH family.
Contains 1 DEP domain.
Contains 1 DIX domain.
Contains 1 PDZ (DHR) domain. -
Domain
The DIX domain promotes homooligomerization.
The DEP domain mediates interaction with the cell membrane. -
Post-translational
modificationsUbiquitinated; undergoes both 'Lys-48'-linked ubiquitination, leading to its subsequent degradation by the ubiquitin-proteasome pathway, and 'Lys-63'-linked ubiquitination. The interaction with INVS is required for ubiquitination. Deubiquitinated by CYLD, which acts on 'Lys-63'-linked ubiquitin chains. -
Cellular localization
Cell membrane. Cytoplasm, cytosol. Cytoplasmic vesicle. Localizes at the cell membrane upon interaction with frizzled family members. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab116823 has not yet been referenced specifically in any publications.