Overview

  • Product name
    Recombinant Human DIXDC1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGGTQVKCLTSPSPIHSAKSESIITQSEEKADFVIIPAEGIENRTEGTDS PLSRDWRPGSPGTYLETSWEEQLLEQQEYLEKEMEEAKKMISGLQALLLN GSLPEDEQERPLALCEPGVNPEEQLIIIQSRLDQSMEENQDLKKELLKCK QEARNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDKDELHNQNVDLQR KLDERNRLLGEYKKELGQKDRLLQQHQAKLEEALRKLSDVSYHQVDLERE LEHKDVLLAHCMKREADEATNYNSHNSQSNGFLLPTAGKGATSVSNRGTS DLQLVRDALRSLRNSFSGHDPQHHTIDSLEQGISSLMERLHVMETQKKQE RKVRVKSPRTQVGSEYRESWPPNSKLPHSQSSPTVSSTCTKVLYFTDRSL TPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHFKALDPEFGTVKEEIFHD DDAIPGWEGKIVAWVEEDHGEN
    • Molecular weight
      78 kDa including tags
    • Amino acids
      1 to 472

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCD1
    • Ccd1Aalpha1L
    • Ccd1Abeta1L
    • Ccd1BalphaL
    • Ccd1BbetaL
    • Ccd1CL
    • Coiled coil DIX1
    • Coiled coil protein DIX1
    • Coiled-coil protein DIX1
    • Coiled-coil-DIX1
    • DIX domain containing 1
    • DIX domain containing protein 1
    • DIX domain-containing protein 1
    • DIXC1_HUMAN
    • DIXDC1
    • Dixin
    • KIAA1735
    see all
  • Function
    Positive effector of the Wnt signaling pathway; activates WNT3A signaling via DVL2. Regulates JNK activation by AXIN1 and DVL2.
  • Tissue specificity
    Ubiquitously expressed with higher expression in cardiac and skeletal muscles.
  • Sequence similarities
    Belongs to the DIXDC1 family.
    Contains 1 CH (calponin-homology) domain.
    Contains 1 DIX domain.
  • Domain
    The coiled-coil domain mediates interaction with MAP3K4 and inhibition of AXIN1-mediated JNK activation through MAP3K4.
    The DIX domain mediates interaction with AXIN1 and inhibition of AXIN1-mediated JNK activation through MAP3K1. Mediates interaction with DVL2; this interaction is required for activation of Wnt signaling.
  • Post-translational
    modifications
    Phosphorylated on tyrosine and serine residues.
    Polyubiquitinated, leading to its proteasomal degradation. WNT3A signaling increases DIXDC1 protein levels by inhibiting its ubiquitination and subsequent degradation.
  • Cellular localization
    Cytoplasm; Cell junction > focal adhesion. Associated with actin stress fiber at the filament ends and Cytoplasm > cytosol. Colocalizes with gamma-tubulin at the centrosome, both during interphase and mitosis.
  • Information by UniProt

Images

  • ab132746 by 12.5% SDS-PAGE stained with Coomassie blue.

References

ab132746 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132746.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up