Recombinant human DKK1 protein (ab155623)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human DKK1 protein
See all DKK1 proteins and peptides -
Biological activity
Measured by the ability to inhibit Wnt3-a induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells.The ED50 for this effect is typically 0.01-0.12 µg/ml in the presence of 10 ng/ml of rmWnt3a.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQ PYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGN YCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHT KGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGL EIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH -
Predicted molecular weight
26 kDa including tags -
Amino acids
32 to 266 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab155623 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 95% PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- Dickkopf 1
- Dickkopf 1 homolog
- Dickkopf 1 like
see all -
Function
Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. -
Tissue specificity
Placenta. -
Sequence similarities
Belongs to the dickkopf family. -
Domain
The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Human Dkk-1 (His Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
Immobilized Hab155623 at 5 μg/mL (100 μL/well) can bind Human LRP-5, Mouse IgG2a Fc Tag with a linear range of 0.01-0.156 μg/mL
-
SDS-PAGE analysis of reduced ab155623 stained overnight with Coomassie Blue.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab155623 has not yet been referenced specifically in any publications.