Description

  • Product name

    Recombinant Human DKK1 protein
    See all DKK1 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQP YPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNY CKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTK GQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLE IFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      33 to 266
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 33 to 266. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab235067 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Dickkopf 1
    • Dickkopf 1 homolog
    • Dickkopf 1 like
    • Dickkopf homolog 1
    • Dickkopf like protein 1
    • Dickkopf related protein 1
    • Dickkopf WNT signaling pathway inhibitor 1
    • Dickkopf-1
    • Dickkopf-related protein 1
    • DKK 1
    • Dkk-1
    • Dkk1
    • DKK1_HUMAN
    • hDkk 1
    • hDkk-1
    • SK
    see all
  • Function

    Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
  • Tissue specificity

    Placenta.
  • Sequence similarities

    Belongs to the dickkopf family.
  • Domain

    The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235067.

References

ab235067 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235067.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up