Description

  • Product name

    Recombinant Human DKK1 protein (Strep-tag)
    See all DKK1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQ PYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGN YCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHT KGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGL EIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
    • Predicted molecular weight

      29 kDa including tags
    • Amino acids

      32 to 266
    • Tags

      StrepII tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included. NP_036374.1

Specifications

Our Abpromise guarantee covers the use of ab219694 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Dickkopf 1
    • Dickkopf 1 homolog
    • Dickkopf 1 like
    • Dickkopf homolog 1
    • Dickkopf like protein 1
    • Dickkopf related protein 1
    • Dickkopf WNT signaling pathway inhibitor 1
    • Dickkopf-1
    • Dickkopf-related protein 1
    • DKK 1
    • Dkk-1
    • Dkk1
    • DKK1_HUMAN
    • hDkk 1
    • hDkk-1
    • SK
    see all
  • Function

    Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
  • Tissue specificity

    Placenta.
  • Sequence similarities

    Belongs to the dickkopf family.
  • Domain

    The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab219694 stained overnight with Coomassie Blue.

References

ab219694 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219694.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up