Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEM FREVEELMEDTQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNT DTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEEGRRSHECIID EDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMAT RGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLD LITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILL PREVPDEYEVGSFMEEVRQELEDLERSLTEEMALGEPAAAAAALLGGEEI
    • Molecular weight
      65 kDa including tags
    • Amino acids
      1 to 350

Specifications

Our Abpromise guarantee covers the use of ab131852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dickkopf 3
    • Dickkopf 3 homolog
    • Dickkopf 3 homolog (Xenopus laevis)
    • Dickkopf homolog 3
    • Dickkopf related protein 3
    • Dickkopf related protein 3 Precursor
    • Dickkopf WNT signaling pathway inhibitor 3
    • Dickkopf, Xenopus, homolog of, 3
    • Dickkopf-3
    • Dickkopf-related protein 3
    • Dickkopf3
    • DKK 3
    • Dkk-3
    • DKK3
    • DKK3_HUMAN
    • hDkk 3
    • hDkk-3
    • hDkk3
    • Regulated in glioma
    • REIC
    • RIG
    • RIG-like 5-6
    • RIG-like 7-1
    see all
  • Function
    Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
  • Tissue specificity
    Highest expression in heart, brain, and spinal cord.
  • Sequence similarities
    Belongs to the dickkopf family.
  • Domain
    The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6.
  • Post-translational
    modifications
    N- and O-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131852 stained with Coomassie Blue.

References

ab131852 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131852.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up