Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEE MEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNN QTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPC RGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCA FQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGL LCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYEVGSFMEEVRQEL EDLERSLTEEMALGEPAAAAAALLGGEEIVDHHHHHH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      22 to 350
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab151874 was lyophilised from a 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilised protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names
    • Dickkopf 3
    • Dickkopf 3 homolog
    • Dickkopf 3 homolog (Xenopus laevis)
    • Dickkopf homolog 3
    • Dickkopf related protein 3
    • Dickkopf related protein 3 Precursor
    • Dickkopf WNT signaling pathway inhibitor 3
    • Dickkopf, Xenopus, homolog of, 3
    • Dickkopf-3
    • Dickkopf-related protein 3
    • Dickkopf3
    • DKK 3
    • Dkk-3
    • DKK3
    • DKK3_HUMAN
    • hDkk 3
    • hDkk-3
    • hDkk3
    • Regulated in glioma
    • REIC
    • RIG
    • RIG-like 5-6
    • RIG-like 7-1
    see all
  • Function
    Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
  • Tissue specificity
    Highest expression in heart, brain, and spinal cord.
  • Sequence similarities
    Belongs to the dickkopf family.
  • Domain
    The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6.
  • Post-translational
    modifications
    N- and O-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab151874 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up