Overview

  • Product name

    Recombinant Human DKK4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTR KFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPIL ERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFD CGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGL LCRSQLTSNRQHARLRVCQKIEKL
    • Molecular weight

      51 kDa including tags
    • Amino acids

      1 to 224

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced.

General Info

  • Alternative names

    • Dickkopf 4
    • Dickkopf gene 4
    • Dickkopf homolog 4
    • Dickkopf homolog 4 (Xenopus laevis)
    • Dickkopf related protein 4
    • Dickkopf-4
    • Dickkopf-related protein 4 short form
    • Dickkopf4
    • DKK 4
    • Dkk-4
    • DKK4
    • DKK4_HUMAN
    • hDkk 4
    • hDkk-4
    • hDkk4
    • MGC129562
    • MGC129563
    see all
  • Function

    Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
  • Tissue specificity

    Expressed in cerebellum, T-cells, esophagus and lung.
  • Sequence similarities

    Belongs to the dickkopf family.
  • Domain

    The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6.
  • Post-translational
    modifications

    Appears to be not glycosylated.
    Can be proteolytically processed by a furin-like protease.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131845 at approximately 51.3 kDa.

References

ab131845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up