Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQ CICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKD CQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANS CTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTC LQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPNGYGLAYRLTPGVH ELPVQQPEHRILKVSMKELNKKTPVDHHHHHH
    • Molecular weight

      30 kDa including tags
    • Amino acids

      24 to 297
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151926 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names

    • Adipocyte differentiation inhibitor protein
    • Brevideltin
    • Delta like 1 homolog
    • Delta like homolog
    • Delta like protein
    • Delta1
    • DLK
    • DLK 1
    • DLK-1
    • DLK1
    • DLK1_HUMAN
    • FA 1
    • FA1
    • Fetal antigen 1
    • pG2
    • Preadipocyte factor 1
    • Pref
    • Pref 1
    • Pref1
    • Protein delta homolog 1
    • Secredeltin
    • ZOG
    see all
  • Function

    May have a role in neuroendocrine differentiation.
  • Tissue specificity

    Found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. Found also in some forms of neuroendocrine lung tumor tissue.
  • Sequence similarities

    Contains 6 EGF-like domains.
  • Post-translational
    modifications

    N- and O-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab151926 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151926.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up