Description

  • Product name

    Recombinant Human DLK-1 protein (Fc Chimera)
    See all DLK-1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 0.010 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTATEALLRVLLLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQ GPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANN RTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGR ASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGF IDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRAL SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT EGQ
    • Predicted molecular weight

      32 kDa
    • Amino acids

      1 to 303
    • Additional sequence information

      Signal peptide and extracellular domain of Human DLK1 (equivalent to full length mature form of fetal antigen 1) fused at the C terminus to the Fc portion of Human IgG1.

Specifications

Our Abpromise guarantee covers the use of ab213523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 0.02% CHAPS, 99% PBS

  • Reconstitution
    Reconstitute with 100 µL sterile water. Concentration 0.1 mg/mL after reconstitution. PBS containing at least 0.1% BSA should be used for further dilutions.

General Info

  • Alternative names

    • Adipocyte differentiation inhibitor protein
    • Brevideltin
    • Delta like 1 homolog
    • Delta like homolog
    • Delta like protein
    • Delta1
    • DLK
    • DLK 1
    • DLK-1
    • DLK1
    • DLK1_HUMAN
    • FA 1
    • FA1
    • Fetal antigen 1
    • pG2
    • Preadipocyte factor 1
    • Pref
    • Pref 1
    • Pref1
    • Protein delta homolog 1
    • Secredeltin
    • ZOG
    see all
  • Function

    May have a role in neuroendocrine differentiation.
  • Tissue specificity

    Found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. Found also in some forms of neuroendocrine lung tumor tissue.
  • Sequence similarities

    Contains 6 EGF-like domains.
  • Post-translational
    modifications

    N- and O-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab213523 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab213523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up