Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHY QASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIR
    • Amino acids
      18 to 109
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Delta
    • Delta (Drosophila) like 1
    • Delta like 1
    • Delta like 1 (Drosophila)
    • Delta like 1 protein
    • Delta like protein 1
    • Delta like protein 1 precursor
    • Delta, Drosophila, homolog of 1
    • Delta-like protein 1
    • Delta1
    • DL1
    • DLL 1
    • DLL1
    • DLL1_HUMAN
    • Drosophila Delta homolog 1
    • H-Delta-1
    • OTTHUMP00000017690
    see all
  • Function
    Acts as a ligand for Notch receptors. Blocks the differentiation of progenitor cells into the B-cell lineage while promoting the emergence of a population of cells with the characteristics of a T-cell/NK-cell precursor.
  • Tissue specificity
    Expressed in heart and pancreas, with lower expression in brain and muscle and almost no expression in placenta, lung, liver and kidney.
  • Sequence similarities
    Contains 1 DSL domain.
    Contains 8 EGF-like domains.
  • Post-translational
    modifications
    Ubiquitinated by MIB (MIB1 or MIB2), leading to its endocytosis and subsequent degradation.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162166 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162166 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162166.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up