Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      HAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYR VICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPI
    • Amino acids

      123 to 221
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AOS6
    • Delta 4
    • delta 4 precursor
    • Delta ligand 4
    • delta ligand 4 precursor
    • Delta like 4
    • Delta like 4 homolog
    • Delta like 4 protein
    • Delta like canonical Notch ligand 4
    • Delta like protein 4
    • Delta-like 4 (Drosophila)
    • Delta-like protein 4
    • Delta4
    • DLL 4
    • Dll4
    • DLL4_HUMAN
    • Drosophila Delta homolog 4
    • hdelta2
    • Homeobox protein DLL-4
    • MGC126344
    • Notch ligand delta 2
    • Notch ligand DLL4
    • Notch ligand DLL4 precursor
    • XDLL-4
    see all
  • Function

    Plays a role in the Notch signaling pathway. Activates Notch-1 and Notch-4.
  • Tissue specificity

    Expressed in vascular endothelium.
  • Sequence similarities

    Contains 1 DSL domain.
    Contains 8 EGF-like domains.
  • Domain

    The Delta-Serrate-Lag2 (DSL) domain is required for binding to the Notch receptor.
  • Post-translational
    modifications

    Ubiquitinated by MIB (MIB1 or MIB2), leading to its endocytosis and subsequent degradation.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab153379 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153379 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up