Description

  • Product name

    Recombinant Human DLL4 protein (His tag)
    See all DLL4 proteins and peptides
  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SGVFQLQLQEFINERGVLASGRPCEPGCRTFFRVCLKHFQAVVSPGPCTF GTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIEAWHAPG DDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICS DNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGC HEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGW GGLFCDQDLNYCTHHSPCKNGATCSNSGQRSYTCTCRPGYTGVDCELELS ECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCEHSTLSCADSPCFNGGS CRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNRGPSRMC RCRPGFTGTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCE VRTSIDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLP
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      27 to 524
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab219667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 5% Trehalose, PBS

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • AOS6
    • Delta 4
    • delta 4 precursor
    • Delta ligand 4
    • delta ligand 4 precursor
    • Delta like 4
    • Delta like 4 homolog
    • Delta like 4 protein
    • Delta like canonical Notch ligand 4
    • Delta like protein 4
    • Delta-like 4 (Drosophila)
    • Delta-like protein 4
    • Delta4
    • DLL 4
    • Dll4
    • DLL4_HUMAN
    • Drosophila Delta homolog 4
    • hdelta2
    • Homeobox protein DLL-4
    • MGC126344
    • Notch ligand delta 2
    • Notch ligand DLL4
    • Notch ligand DLL4 precursor
    • XDLL-4
    see all
  • Function

    Plays a role in the Notch signaling pathway. Activates Notch-1 and Notch-4.
  • Tissue specificity

    Expressed in vascular endothelium.
  • Sequence similarities

    Contains 1 DSL domain.
    Contains 8 EGF-like domains.
  • Domain

    The Delta-Serrate-Lag2 (DSL) domain is required for binding to the Notch receptor.
  • Post-translational
    modifications

    Ubiquitinated by MIB (MIB1 or MIB2), leading to its endocytosis and subsequent degradation.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab219667 on SDS-PAGE under reducing (R) conditions.

    The gel was stained overnight with Coomassie Blue.

    The purity of the protein is greater than 92%.

    The protein migrates as 65 kDa under reducing (R) conditions due to glycosylation.

References

ab219667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up