Overview

  • Product name
    Recombinant Human DLX3 protein (His tag) (denatured)
    See all DLX3 proteins and peptides
  • Protein length
    Protein fragment
  • Description
    Recombinant Human DLX3 protein (His tag)

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHH SSGLVPRGSH MGSMSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQ HDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGA YREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRR FQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK
    • Molecular weight
      23 kDa including tags
    • Amino acids
      1 to 186
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NP_005211).

Specifications

Our Abpromise guarantee covers the use of ab174407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • AI4
    • Distal less homeo box 3
    • DLX 3
    • Dlx3
    • DLX3 distalless homeobox 3
    • DLX3_HUMAN
    • Homeobox protein DLX 3
    • Homeobox protein DLX-3
    • Homeobox protein Dlx3
    • TDO
    see all
  • Function
    Likely to play a regulatory role in the development of the ventral forebrain. May play a role in craniofacial patterning and morphogenesis.
  • Involvement in disease
    Defects in DLX3 are a cause of trichodentoosseous syndrome (TDO) [MIM:190320]. TDO is an autosomal dominant syndrome characterized by enamel hypoplasia and hypocalcification with associated strikingly curly hair.
    Defects in DLX3 are the cause of amelogenesis imperfecta type 4 (AI4) [MIM:104510]; also known as amelogenesis imperfecta hypomaturation-hypoplastic type with taurodontism. AI4 is an autosomal dominant defect of enamel formation associated with enlarged pulp chambers.
  • Sequence similarities
    Belongs to the distal-less homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174407 at 3μg.

References

ab174407 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up