Description

  • Product name

    Recombinant Human DMRT1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGS SRGGGSGSGASDLGAGSKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDC QCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHPIPLPSAAELLVKRE NNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENT PDLVSDSTYYSSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGG SPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYL GQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKA VLECEPASEPSSFTVTPVIEEDE
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      1 to 373

Specifications

Our Abpromise guarantee covers the use of ab114958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CT154
    • DM domain expressed in testis 1
    • DM domain expressed in testis protein 1
    • DM domain gene expressed in testis
    • DMRT 1
    • dmrt1
    • DMRT1_HUMAN
    • DMT 1
    • DMT1
    • Doublesex and mab 3 related transcription factor 1
    • Doublesex- and mab-3-related transcription factor 1
    see all
  • Function

    May be required for testis development.
  • Tissue specificity

    Testis specific.
  • Sequence similarities

    Belongs to the DMRT family.
    Contains 1 DM DNA-binding domain.
  • Developmental stage

    Expressed in the genital ridges of six-week-old male embryos. Becomes confined to the forming seminiferous tubules (possibly Sertoli cells) at seven weeks. Not detected in female embryos.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114958 at approximately 67.14kDa.
    Stained with Coomassie Blue.

References

ab114958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up