Overview

  • Product name
    Recombinant Human DMTF1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVPSPHGFIQASD VIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH
    • Amino acids
      661 to 760
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160747 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cyclin D binding Myb like protein
    • Cyclin D binding Myb like transcription factor 1
    • cyclin D binding myb like transcription factor 1D interacting myb like protein
    • Cyclin D interacting Myb like protein 1
    • Cyclin-D-binding Myb-like transcription factor 1
    • Cyclin-D-interacting Myb-like protein 1
    • D interacting myb like protein
    • DMP1
    • DMTF
    • dmtf1
    • DMTF1_HUMAN
    • hDMP1
    • hDMTF1
    • mDmp1
    see all
  • Function
    Transcriptional activator which activates the CDKN2A/ARF locus in response to Ras-Raf signaling, thereby promoting p53/TP53-dependent growth arrest (By similarity). Binds to the consensus sequence 5'-CCCG[GT]ATGT-3' (By similarity). Isoform 1 may cooperate with MYB to activate transcription of the ANPEP gene. Isoform 2 may antagonize transcriptional activation by isoform 1.
  • Tissue specificity
    Expressed at relatively low levels in colonic mucosa, ovary, peripheral leukocytes, prostate and small intestine, and at higher levels in spleen, testis and thymus. Expressed in multiple regions of the brain and CNS including amygdala, caudate, corpus callosum, hippocampus, substantia nigra and subthalamic nucleus. Isoform 1 is the predominant isoform in monocytes, macrophages and neutrophils, isoform 2 is most strongly expressed in peripheral blood leukocytes and quiescent CD34 positive cells, and isoform 3 is expressed at low levels in all hematopoietic cell types. Expression is frequently reduced in non-small-cell lung carcinomas (NSCLC) due to hemizygous gene deletion, strongly suggesting that this locus is haploinsufficient for tumor suppression. Loss of this locus frequently occurs in tumors which retain wild-type CDKN2A/ARF and p53/TP53 loci. Hemizygous gene deletion has also been observed in leukemic blasts from patients with abnormalities of the long arm of chromosome 7.
  • Sequence similarities
    Belongs to the DMTF1 family.
    Contains 1 HTH myb-type DNA-binding domain.
    Contains 2 Myb-like domains.
  • Developmental stage
    Isoform 2 expression is down-regulated during myeloid differentiation, while the expression of isoform 1 and isoform 3 remain constant.
  • Post-translational
    modifications
    Phosphorylated by the cyclin-D2/CDK4, cyclin-D3/CDK4 and cyclin-D2/CDK6 complexes and to a lesser extent by the cyclin-D1/CDK4 complex.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160747 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160747 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160747.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up