Overview

  • Product name

    Recombinant Human DN-7 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTI LDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKN QTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGA VSNKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPA TTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDI M
    • Amino acids

      1 to 251
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DN-7
    • DN7
    • Neuronal cell death related protein 7
    • Neuronal cell death-related protein 7
    • TAF9-like RNA polymerase II TBP associated factor, 31 kD
    • Taf9b
    • TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
    • TAF9B_HUMAN
    • TAF9L
    • TAFII31L
    • TFIID-31
    • Transcription initiation factor TFIID subunit 9-like
    • Transcription initiation factor TFIID subunit 9-like protein
    • Transcription initiation factor TFIID subunit 9B
    • Transcription-associated factor TAFII31L
    see all
  • Function

    Essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes. May have a role in gene regulation associated with apoptosis. TAFs are components of the transcription factor IID (TFIID) complex, the TBP-free TAFII complex (TFTC), the PCAF histone acetylase complex and the STAGA transcription coactivator-HAT complex. TFIID or TFTC are essential for the regulation of RNA polymerase II-mediated transcription.
  • Sequence similarities

    Belongs to the TAF9 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab162613 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up