Recombinant Human DNA PKcs protein (Tagged) (ab204152)
Key features and details
- Expression system: Baculovirus infected Sf9 cells
- Purity: > 75% Densitometry
- Tags: GST tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human DNA PKcs protein (Tagged)
See all DNA PKcs proteins and peptides -
Purity
> 75 % Densitometry.
Affinity purified. -
Expression system
Baculovirus infected Sf9 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
REHPFLVKGGEDLRQDQRVEQLFQVMNGILAQDSACSQRALQLRTYSVVP MTSRLGLIEWLENTVTLKDLLLNTMSQEEKAAYLSDPRAPPCEYKDWLTK MSGKHDVGAYMLMYKGANRTETVTSFRKRESKVPADLLKRAFVRMSTSPE AFLALRSHFASSHALICISHWILGIGDRHLNNFMVAMETGGVIGIDFGHA FGSATQFLPVPELMPFRLTRQFINLMLPMKETGLMYSIMVHALRAFRSDP GLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKIC YAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPE SGLSE ETQVKCLMDQATDPNILGRTWEGWEPWM -
Predicted molecular weight
68 kDa including tags -
Amino acids
3746 to 4128 -
Tags
GST tag N-Terminus -
Additional sequence information
NM_006904
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab204152 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.50
Constituents: 0.79% Tris HCl, 0.88% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- DNA dependent protein kinase catalytic subunit
- DNA PK catalytic subunit
- DNA-dependent protein kinase catalytic subunit
see all -
Function
Serine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Also involved in modulation of transcription. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX, thereby regulating DNA damage response mechanism. Phosphorylates DCLRE1C, c-Abl/ABL1, histone H1, HSPCA, c-jun/JUN, p53/TP53, PARP1, POU2F1, DHX9, SRF, XRCC1, XRCC1, XRCC4, XRCC5, XRCC6, WRN, MYC and RFA2. Can phosphorylate C1D not only in the presence of linear DNA but also in the presence of supercoiled DNA. Ability to phosphorylate p53/TP53 in the presence of supercoiled DNA is dependent on C1D. -
Sequence similarities
Belongs to the PI3/PI4-kinase family.
Contains 1 FAT domain.
Contains 1 FATC domain.
Contains 2 HEAT repeats.
Contains 1 PI3K/PI4K domain.
Contains 3 TPR repeats. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. Autophosphorylated on Thr-2609, Thr-2638 and Thr-2647. Thr-2609 is a DNA damage-inducible phosphorylation site (inducible with ionizing radiation, IR). Autophosphorylation induces a conformational change that leads to remodeling of the DNA-PK complex, requisite for efficient end processing and DNA repair.
S-nitrosylated by GAPDH. -
Cellular localization
Nucleus. - Information by UniProt
Images
-
SDS-PAGE analysis of ab204512 which was determined to be >75% pure by densitometry.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab204152 has not yet been referenced specifically in any publications.