Description

  • Product name

    Recombinant Human DNA PKcs protein (Tagged)
    See all DNA PKcs proteins and peptides
  • Purity

    > 75 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      REHPFLVKGGEDLRQDQRVEQLFQVMNGILAQDSACSQRALQLRTYSVVP MTSRLGLIEWLENTVTLKDLLLNTMSQEEKAAYLSDPRAPPCEYKDWLTK MSGKHDVGAYMLMYKGANRTETVTSFRKRESKVPADLLKRAFVRMSTSPE AFLALRSHFASSHALICISHWILGIGDRHLNNFMVAMETGGVIGIDFGHA FGSATQFLPVPELMPFRLTRQFINLMLPMKETGLMYSIMVHALRAFRSDP GLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKIC YAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPE SGLSE ETQVKCLMDQATDPNILGRTWEGWEPWM
    • Predicted molecular weight

      68 kDa including tags
    • Amino acids

      3746 to 4128
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_006904

Specifications

Our Abpromise guarantee covers the use of ab204152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.88% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

General Info

  • Alternative names

    • DNA dependent protein kinase catalytic subunit
    • DNA PK catalytic subunit
    • DNA-dependent protein kinase catalytic subunit
    • DNA-PK catalytic subunit
    • DNA-PKcs
    • DNAPK
    • DNAPK catalytic subunit
    • DNPK 1
    • DNPK1
    • Hyper radiosensitivity of murine scid mutation, complementing 1
    • Hyperradiosensitivity complementing 1, mouse, homolog of 1
    • HYRC
    • HYRC 1
    • HYRC1
    • IMD26
    • p350
    • p460
    • PKRDC
    • PRKDC
    • PRKDC_HUMAN
    • Protein Kinase DNA Activated Catalytic Polypeptide
    • XRCC 7
    • XRCC7
    see all
  • Function

    Serine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Also involved in modulation of transcription. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX, thereby regulating DNA damage response mechanism. Phosphorylates DCLRE1C, c-Abl/ABL1, histone H1, HSPCA, c-jun/JUN, p53/TP53, PARP1, POU2F1, DHX9, SRF, XRCC1, XRCC1, XRCC4, XRCC5, XRCC6, WRN, MYC and RFA2. Can phosphorylate C1D not only in the presence of linear DNA but also in the presence of supercoiled DNA. Ability to phosphorylate p53/TP53 in the presence of supercoiled DNA is dependent on C1D.
  • Sequence similarities

    Belongs to the PI3/PI4-kinase family.
    Contains 1 FAT domain.
    Contains 1 FATC domain.
    Contains 2 HEAT repeats.
    Contains 1 PI3K/PI4K domain.
    Contains 3 TPR repeats.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR. Autophosphorylated on Thr-2609, Thr-2638 and Thr-2647. Thr-2609 is a DNA damage-inducible phosphorylation site (inducible with ionizing radiation, IR). Autophosphorylation induces a conformational change that leads to remodeling of the DNA-PK complex, requisite for efficient end processing and DNA repair.
    S-nitrosylated by GAPDH.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab204512 which was determined to be >75% pure by densitometry.

References

ab204152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up