Description

  • Product name

    Recombinant Human DNA Polymerase beta protein
    See all DNA Polymerase beta proteins and peptides
  • Purity

    >= 84 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHSKRKAPQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAAS VIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTS SSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFG DFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVL LTHPSFTSESTKQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSK NDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTIN EYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      2 to 335
    • Tags

      His tag N-Terminus
    • Additional sequence information

      GenBank Accession No. NM_002690

Specifications

Our Abpromise guarantee covers the use of ab196082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Preservative: 1.7% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

General Info

  • Alternative names

    • DNA directed DNA polymerase beta
    • DNA pol beta
    • DNA polymerase beta
    • DNA polymerase beta subunit
    • DPOLB_HUMAN
    • MGC125976
    • Pol B
    • Pol beta
    • POLB
    • Polymerase (DNA directed) beta
    see all
  • Function

    Repair polymerase. Conducts "gap-filling" DNA synthesis in a stepwise distributive fashion rather than in a processive fashion as for other DNA polymerases. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.
  • Sequence similarities

    Belongs to the DNA polymerase type-X family.
  • Domain

    Residues 239-252 form a flexible loop which appears to affect the polymerase fidelity.
  • Post-translational
    modifications

    Methylation by PRMT6 stimulates the polymerase activity by enhancing DNA binding and processivity.
  • Cellular localization

    Nucleus, Cytoplasm
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 2.6 µg ab196082 with Coomassie staining.

References

ab196082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196082.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up