Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFY GNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLS NTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRA AMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEA YLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISP LLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFR IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLP IRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISL GLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKER LKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDADF PHPLRLRLMGVRISSFPNEEDRKHQQRSIIGFLQAGNQALSATECTLEKT DKDKFVKPLE
    • Molecular weight
      64 kDa
    • Amino acids
      1 to 560
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab176956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

    Functional Studies

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • DinB homolog 1 (E. coli)
    • DINB protein
    • DINB1
    • DINP
    • DNA damage inducible protein b
    • DNA polymerase kappa
    • Polk
    • POLK_HUMAN
    • POLQ
    • Polymerase (DNA directed) kappa
    • polymerase, DNA, kappa
    see all
  • Function
    DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. Lacks 3'-5' proofreading exonuclease activity. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have lyase activity.
  • Tissue specificity
    Detected at low levels in testis, spleen, prostate and ovary. Detected at very low levels in kidney, colon, brain, heart, liver, lung, placenta, pancreas and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the DNA polymerase type-Y family.
    Contains 2 UBZ-type zinc fingers.
    Contains 1 umuC domain.
  • Domain
    The catalytic core consists of fingers, palm and thumb subdomains, but the fingers and thumb subdomains are much smaller than in high-fidelity polymerases; residues from five sequence motifs of the Y-family cluster around an active site cleft that can accommodate DNA and nucleotide substrates with relaxed geometric constraints, with consequently higher rates of misincorporation and low processivity.
  • Cellular localization
    Nucleus. Detected throughout the nucleus and at replication foci.
  • Information by UniProt

Images

  • DNA polymerizing activity of ab176956
    50 mM Tris-HCl pH 8.0, 2 mM MgCl2, 1 mM DTT, 0.1 mg / ml BSA, 0.1 mM dNTP, 100 nM primer/template(13-mer/30-mer), DNA polymerase kappa/POLK at 13~50 ng/25μl (lanes 1,2, and 3 respectiviely) per assay, incubated at 37℃ for 10 min.

  • SDS-PAGE analysis of ab196956.

References

ab176956 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up