Description

  • Product name

    Recombinant Human DNA Polymerase theta protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DGFVQTILGRRRYLPGIKDNNPYRKAHAERQAINTIVQGSAADIVKIATV NIQKQLETFHSTFKSHGHREGMLQSDRTGLSRKRKLQGMFCPIRGGFFIL QLHDELLYE
    • Amino acids

      2572 to 2680
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp781A0112
    • DNA polymerase eta
    • DNA polymerase theta
    • DPOLQ_HUMAN
    • POLH
    • POLQ
    • Polymerase (DNA directed) theta
    • PRO0327
    see all
  • Function

    Has a DNA polymerase activity on nicked double-stranded DNA and on a singly primed DNA template. The enzyme activity is resistant to aphidicolin, and inhibited by dideoxynucleotides. Exhibites a single-stranded DNA-dependent ATPase activity. Could be involved in the repair of interstrand cross-links.
  • Tissue specificity

    Highly expressed in testis.
  • Sequence similarities

    Belongs to the DNA polymerase type-A family.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Information by UniProt

Images

  • ab161121 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161121 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161121.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up