Overview

  • Product name

    Recombinant Human DNAJA2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEI SFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFM GNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQG GKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKD RCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVL LLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVKYPP GKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDRLSE LEDLLPSRPEVPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESS SHHGPGVQCAHQ
    • Molecular weight

      71 kDa including tags
    • Amino acids

      1 to 412

Specifications

Our Abpromise guarantee covers the use of ab132607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cell cycle progression 3 protein
    • Cell cycle progression restoration gene 3 protein
    • CPR 3
    • CPR3
    • Dj3
    • DJA 2
    • DJA2
    • DNAJ
    • DnaJ (Hsp40) homolog subfamily A member 2
    • DnaJ heat shock protein family (Hsp40) member A2
    • DnaJ homolog subfamily A member 2
    • DNAJA 2
    • Dnaja2
    • DNJ 3
    • Dnj3
    • DNJA2_HUMAN
    • HIRA interacting protein 4
    • HIRA-interacting protein 4
    • HIRIP 4
    • HIRIP4
    • OTTHUMP00000164136
    • PRO3015
    • RDJ 2
    • RDJ2
    • Renal carcinoma antigen NY REN 14
    • Renal carcinoma antigen NY-REN-14
    see all
  • Function

    Co-chaperone of Hsc70.
  • Sequence similarities

    Contains 1 CR-type zinc finger.
    Contains 1 J domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132607 stained with Coomassie Blue.

References

ab132607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up