Overview

  • Product name
    Recombinant Human DNAJA4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQ AYEVLSDPKKRDVYDQGGEQAIKEGGSGSPSFSSPMDIFDMFFGGGGRMA RERRGKNVVHQLSVTLEDLYNGVTKKLALQKNVICEKCEGVGGKKGSVEK CPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCESCSGA KVIREKKIIEVHVEKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHS VFQRRGHDLIMKMKIQLSEALCGFKKTIKTLDNRILVITSKAGEVIKHGD LRCVRDEGMPIYKAPLEKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPR QKVRITDDMDQVELKEFCPNEQNWRQHREAYEEDEDGPQAGVQCQTA
    • Amino acids
      1 to 397
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163097 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DnaJ (Hsp40) homolog subfamily A member 4
    • DnaJ (Hsp40) homolog, subfamily A, member4
    • DNAJ A4
    • DnaJ heat shock protein family (Hsp40) member A4
    • DnaJ homolog subfamily A member 4
    • DNAJA 4
    • DNAJA4
    • DNJA4_HUMAN
    • MST104
    • MSTP104
    • PRO1472
    see all
  • Sequence similarities
    Contains 1 CR-type zinc finger.
    Contains 1 J domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163097 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163097 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163097.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up