Overview

  • Product name

    Recombinant Human DNAJB9 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLA MKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQ RGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSS RQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSS KHCRTVTQRRGNMVTTYTDCSGQ
    • Molecular weight

      52 kDa including tags
    • Amino acids

      1 to 223

Specifications

Our Abpromise guarantee covers the use of ab132017 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZP564F1862
    • DnaJ (Hsp40) homolog subfamily B member 9
    • DnaJ homolog subfamily B member 9
    • DNAJB9
    • DNJB9_HUMAN
    • eEndoplasmic reticulum DNA J domain containing protein 4
    • Endoplasmic reticulum DnaJ homolog 4
    • ER resident protein ERdj4
    • ERdj4
    • MDG 1
    • Mdg-1
    • MDG1
    • Microvascular endothelial differentiation gene 1
    • Microvascular endothelial differentiation gene 1 protein
    • MST049
    • MSTP049
    • OTTHUMP00000206840
    see all
  • Function

    Acts as a co-chaperone with an Hsp70 protein.
  • Sequence similarities

    Contains 1 J domain.
  • Cellular localization

    Cytoplasm. Nucleus. Stress induces its translocation to the nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132017 at approximately 51.9 kDa.

References

ab132017 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132017.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up