Overview

  • Product name

    Recombinant Human DNAJC7 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPK NASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLG NAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRK VVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNA DALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKK EDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKL DDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKT KEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHP DRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNM GDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG
    • Molecular weight

      79 kDa including tags
    • Amino acids

      11 to 494

Specifications

Our Abpromise guarantee covers the use of ab132632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DJ11
    • DJC7
    • DnaJ (Hsp40) homolog subfamily C member 7
    • DnaJ homolog subfamily C member 7
    • Dnajc7
    • DNJC7_HUMAN
    • Tetratricopeptide repeat domain 2
    • Tetratricopeptide repeat protein 2
    • TPR repeat protein 2
    • TPR2
    • TTC2
    see all
  • Function

    Acts as co-chaperone regulating the molecular chaperones HSP70 and HSP90 in folding of steroid receptors, such as the glucocorticoid receptor and the progesterone receptor. Proposed to act as a recycling chaperone by facilitating the return of chaperone substrates to early stages of chaperoning if further folding is required. In vitro, induces ATP-independent dissociation of HSP90 but not of HSP70 from the chaperone-substrate complexes. Recruits NR1I3 to the cytoplasm.
  • Sequence similarities

    Contains 1 J domain.
    Contains 9 TPR repeats.
  • Cellular localization

    Cytoplasm. Nucleus. Cytoplasm > cytoskeleton. Colocalizes with NR1I3 to microtubules.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of stained with Coomassie Blue.

References

ab132632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up