Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCVSPKGPWTCVG DMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSRAYKI
    • Amino acids
      261 to 360
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acid DNase
    • Deoxyribonuclease 2
    • Deoxyribonuclease 2 alpha
    • Deoxyribonuclease II
    • Deoxyribonuclease II alpha
    • Deoxyribonuclease II lysosomal
    • Deoxyribonuclease-2-alpha
    • Deoxyribonuclease2
    • DeoxyribonucleaseII
    • DNASE 2
    • DNASE 2A
    • DNase II alpha
    • DNase II lysosomal
    • DNASE2
    • DNASE2A
    • DNaseII
    • DNL
    • DNL 2
    • DNL2
    • DNS2A_HUMAN
    • Lysosomal DNase II
    • R31240 2
    • R31240_2
    see all
  • Function
    Hydrolyzes DNA under acidic conditions with a preference for double-stranded DNA. Plays a major role in the degradation of nuclear DNA in cellular apoptosis during development. Necessary for proper fetal development and for definitive erythropoiesis in fetal liver, where it degrades nuclear DNA expelled from erythroid precursor cells.
  • Sequence similarities
    Belongs to the DNase II family.
  • Post-translational
    modifications
    Glycosylated. Mutations that eliminate N-glycosylation sites reduce activity, but enzymatic deglycosylation has no effect.
  • Cellular localization
    Lysosome.
  • Information by UniProt

Images

  • ab158296 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up