Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQ YKYLDESSGGWRDGRALINSPEGAVGRSLQPLYRSNTSQLAFLLYNDQPP QPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPASSAAYSWPHSA CTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENV VKGHHVSQEPWNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTN LQVQFWHKTVGILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCV SPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGM ARKPSRAYKI
    • Molecular weight

      66 kDa including tags
    • Amino acids

      1 to 360

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131772 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as DNase II

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Acid DNase
    • Deoxyribonuclease 2
    • Deoxyribonuclease 2 alpha
    • Deoxyribonuclease II
    • Deoxyribonuclease II alpha
    • Deoxyribonuclease II lysosomal
    • Deoxyribonuclease-2-alpha
    • Deoxyribonuclease2
    • DeoxyribonucleaseII
    • DNASE 2
    • DNASE 2A
    • DNase II alpha
    • DNase II lysosomal
    • DNASE2
    • DNASE2A
    • DNaseII
    • DNL
    • DNL 2
    • DNL2
    • DNS2A_HUMAN
    • Lysosomal DNase II
    • R31240 2
    • R31240_2
    see all
  • Function

    Hydrolyzes DNA under acidic conditions with a preference for double-stranded DNA. Plays a major role in the degradation of nuclear DNA in cellular apoptosis during development. Necessary for proper fetal development and for definitive erythropoiesis in fetal liver, where it degrades nuclear DNA expelled from erythroid precursor cells.
  • Sequence similarities

    Belongs to the DNase II family.
  • Post-translational
    modifications

    Glycosylated. Mutations that eliminate N-glycosylation sites reduce activity, but enzymatic deglycosylation has no effect.
  • Cellular localization

    Lysosome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131772 stained with Coomassie Blue.

References

ab131772 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131772.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up